SCOPe 2.07: Domain d3zgdb_: 3zgd B:

Lineage for d3zgdb_ (3zgd B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.11: Kelch motif [117281] (2 families)

5. Family b.68.11.1: Kelch motif [117282] (2 proteins)
   Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)

6. Protein automated matches [190126] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193097] (25 PDB entries)

8. Domain d3zgdb_: 3zgd B: [218290]
   automated match to d1zgka1
   complexed with act, na; mutant

Details for d3zgdb_

PDB Entry: 3zgd, 1.98 Å

PDB Description: crystal structure of a KEAP1 mutant

PDB Compounds: (B:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d3zgdb_:

Sequence; same for both SEQRES and ATOM records:

>d3zgdb_ b.68.11.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggrnnsp
dgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsverye
perdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitamn
tirsgagvcvlhnciyaaggydgqdqlnsverydvatatwtfvapmkhrrsalgitvhqg
riyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt

Timeline for d3zgdb_:

• d3zgdb_ first appeared in SCOPe 2.03
  
• d3zgdb_ appears in SCOPe 2.06
  
• d3zgdb_ appears in the current release, SCOPe 2.08