Lineage for d1cxla1 (1cxl A:497-583)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9616Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species)
  7. 9617Species Bacillus circulans, different strains [TaxId:1397] [49216] (27 PDB entries)
  8. 9623Domain d1cxla1: 1cxl A:497-583 [21829]
    Other proteins in same PDB: d1cxla2, d1cxla3, d1cxla4

Details for d1cxla1

PDB Entry: 1cxl (more details), 1.81 Å

PDB Description: complex between a covalent intermediate and bacillus circulans strain 251 cgtase e257q

SCOP Domain Sequences for d1cxla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cxla1 b.1.1.5 (A:497-583) Cyclodextrin glycosyltransferase, domain E {Bacillus circulans, different strains}
atptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipav
aggnynikvanaagtasnvydnfevls

SCOP Domain Coordinates for d1cxla1:

Click to download the PDB-style file with coordinates for d1cxla1.
(The format of our PDB-style files is described here.)

Timeline for d1cxla1: