Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (107 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188013] (58 PDB entries) |
Domain d3zfla1: 3zfl A:2-80 [218285] Other proteins in same PDB: d3zfla2, d3zflb2 automated match to d1k3ya2 mutant |
PDB Entry: 3zfl (more details), 1.88 Å
SCOPe Domain Sequences for d3zfla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zfla1 c.47.1.0 (A:2-80) automated matches {Human (Homo sapiens) [TaxId: 9606]} aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmaeid gmklvqtrailnyiaskyn
Timeline for d3zfla1: