Lineage for d3zfla1 (3zfl A:2-80)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1370148Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1370149Protein automated matches [190056] (107 species)
    not a true protein
  7. 1370432Species Human (Homo sapiens) [TaxId:9606] [188013] (58 PDB entries)
  8. 1370528Domain d3zfla1: 3zfl A:2-80 [218285]
    Other proteins in same PDB: d3zfla2, d3zflb2
    automated match to d1k3ya2
    mutant

Details for d3zfla1

PDB Entry: 3zfl (more details), 1.88 Å

PDB Description: crystal structure of the v58a mutant of human class alpha glutathione transferase in the apo form
PDB Compounds: (A:) glutathione s-transferase a1

SCOPe Domain Sequences for d3zfla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zfla1 c.47.1.0 (A:2-80) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmaeid
gmklvqtrailnyiaskyn

SCOPe Domain Coordinates for d3zfla1:

Click to download the PDB-style file with coordinates for d3zfla1.
(The format of our PDB-style files is described here.)

Timeline for d3zfla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zfla2