Lineage for d3zfbb2 (3zfb B:81-209)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713549Protein automated matches [226848] (14 species)
    not a true protein
  7. 2713569Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries)
  8. 2713639Domain d3zfbb2: 3zfb B:81-209 [218284]
    Other proteins in same PDB: d3zfba1, d3zfbb1
    automated match to d1agsa1
    mutant

Details for d3zfbb2

PDB Entry: 3zfb (more details), 1.86 Å

PDB Description: crystal structure of the i75a mutant of human class alpha glutathione transferase in the apo form
PDB Compounds: (B:) glutathione s-transferase a1

SCOPe Domain Sequences for d3zfbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zfbb2 a.45.1.1 (B:81-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmd

SCOPe Domain Coordinates for d3zfbb2:

Click to download the PDB-style file with coordinates for d3zfbb2.
(The format of our PDB-style files is described here.)

Timeline for d3zfbb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zfbb1