SCOPe 2.07: Domain d3zfbb1: 3zfb B:4-80

Lineage for d3zfbb1 (3zfb B:4-80)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)

8. Domain d3zfbb1: 3zfb B:4-80 [218283]
   Other proteins in same PDB: d3zfba2, d3zfbb2
   automated match to d1k3ya2
   mutant

Details for d3zfbb1

PDB Entry: 3zfb, 1.86 Å

PDB Description: crystal structure of the i75a mutant of human class alpha glutathione transferase in the apo form

PDB Compounds: (B:) glutathione s-transferase a1

SCOPe Domain Sequences for d3zfbb1:

Sequence; same for both SEQRES and ATOM records:

>d3zfbb1 c.47.1.0 (B:4-80) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveidgm
klvqtrailnyaaskyn

Timeline for d3zfbb1:

• d3zfbb1 first appeared in SCOPe 2.03
  
• d3zfbb1 appears in SCOPe 2.06
  
• d3zfbb1 appears in the current release, SCOPe 2.08