SCOPe 2.08: Domain d3zfba2: 3zfb A:81-209

Lineage for d3zfba2 (3zfb A:81-209)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries)

8. Domain d3zfba2: 3zfb A:81-209 [218282]
   Other proteins in same PDB: d3zfba1, d3zfbb1
   automated match to d1agsa1
   mutant

Details for d3zfba2

PDB Entry: 3zfb, 1.86 Å

PDB Description: crystal structure of the i75a mutant of human class alpha glutathione transferase in the apo form

PDB Compounds: (A:) glutathione s-transferase a1

SCOPe Domain Sequences for d3zfba2:

Sequence; same for both SEQRES and ATOM records:

>d3zfba2 a.45.1.1 (A:81-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmd

Timeline for d3zfba2:

• d3zfba2 first appeared in SCOPe 2.03
  
• d3zfba2 appears in SCOPe 2.07