| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (64 species) not a true protein |
| Species Salmonella enterica [TaxId:909946] [226624] (2 PDB entries) |
| Domain d3zeud1: 3zeu D:1-107 [218279] automated match to d1okja1 complexed with adp, ags, cl, mg, zn |
PDB Entry: 3zeu (more details), 1.65 Å
SCOPe Domain Sequences for d3zeud1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zeud1 c.55.1.0 (D:1-107) automated matches {Salmonella enterica [TaxId: 909946]}
mrilaidtateacsvalwnngtinahfelcprehtqrilpmvqeilaasgaslneidala
fgrgpgsftgvrigigiaqglalganlpmigvstlatmaqgawrktg
Timeline for d3zeud1: