Lineage for d3zeua1 (3zeu A:1-107)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885540Species Salmonella enterica [TaxId:909946] [226624] (2 PDB entries)
  8. 2885541Domain d3zeua1: 3zeu A:1-107 [218277]
    automated match to d1okja1
    complexed with adp, ags, cl, mg, zn

Details for d3zeua1

PDB Entry: 3zeu (more details), 1.65 Å

PDB Description: structure of a salmonella typhimurium ygjd-yeaz heterodimer bound to atpgammas
PDB Compounds: (A:) putative m22 peptidase yeaz

SCOPe Domain Sequences for d3zeua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zeua1 c.55.1.0 (A:1-107) automated matches {Salmonella enterica [TaxId: 909946]}
mrilaidtateacsvalwnngtinahfelcprehtqrilpmvqeilaasgaslneidala
fgrgpgsftgvrigigiaqglalganlpmigvstlatmaqgawrktg

SCOPe Domain Coordinates for d3zeua1:

Click to download the PDB-style file with coordinates for d3zeua1.
(The format of our PDB-style files is described here.)

Timeline for d3zeua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zeua2