Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (63 species) not a true protein |
Species Salmonella enterica [TaxId:909946] [226624] (2 PDB entries) |
Domain d3zeta1: 3zet A:1-107 [218275] automated match to d1okja1 complexed with amp, cd, tam |
PDB Entry: 3zet (more details), 2.31 Å
SCOPe Domain Sequences for d3zeta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zeta1 c.55.1.0 (A:1-107) automated matches {Salmonella enterica [TaxId: 909946]} mrilaidtateacsvalwnngtinahfelcprehtqrilpmvqeilaasgaslneidala fgrgpgsftgvrigigiaqglalganlpmigvstlatmaqgawrktg
Timeline for d3zeta1: