Lineage for d3zeta1 (3zet A:1-107)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858517Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1858518Protein automated matches [226839] (49 species)
    not a true protein
  7. 1858914Species Salmonella enterica [TaxId:909946] [226624] (2 PDB entries)
  8. 1858919Domain d3zeta1: 3zet A:1-107 [218275]
    automated match to d1okja1
    complexed with amp, cd, tam

Details for d3zeta1

PDB Entry: 3zet (more details), 2.31 Å

PDB Description: Structure of a Salmonella typhimurium YgjD-YeaZ heterodimer
PDB Compounds: (A:) putative m22 peptidase yeaz

SCOPe Domain Sequences for d3zeta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zeta1 c.55.1.0 (A:1-107) automated matches {Salmonella enterica [TaxId: 909946]}
mrilaidtateacsvalwnngtinahfelcprehtqrilpmvqeilaasgaslneidala
fgrgpgsftgvrigigiaqglalganlpmigvstlatmaqgawrktg

SCOPe Domain Coordinates for d3zeta1:

Click to download the PDB-style file with coordinates for d3zeta1.
(The format of our PDB-style files is described here.)

Timeline for d3zeta1: