Lineage for d3zdwa1 (3zdw A:2-182)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2043106Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2043107Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2043852Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2044451Protein Spore coat protein A, CotA [89219] (2 species)
  7. 2044452Species Bacillus subtilis [TaxId:1423] [89220] (13 PDB entries)
    Uniprot P07788
  8. 2044474Domain d3zdwa1: 3zdw A:2-182 [218271]
    complexed with cu1, ebs, gol, oxy

Details for d3zdwa1

PDB Entry: 3zdw (more details), 2.4 Å

PDB Description: Substrate and dioxygen binding to the endospore coat laccase CotA from Bacillus subtilis
PDB Compounds: (A:) cota laccase

SCOPe Domain Sequences for d3zdwa1:

Sequence, based on SEQRES records: (download)

>d3zdwa1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]}
tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
vkrnenvyvkwmnnlpsthflpidhtihhsdsqheepevktvvhlhggvtpddsdgypea
wfskdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekr
l

Sequence, based on observed residues (ATOM records): (download)

>d3zdwa1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]}
tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
vkrnenvyvkwmnnlpsthflpidhtihepevktvvhlhggvtpddsdgypeawfskdfe
qtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekrl

SCOPe Domain Coordinates for d3zdwa1:

Click to download the PDB-style file with coordinates for d3zdwa1.
(The format of our PDB-style files is described here.)

Timeline for d3zdwa1: