Lineage for d3zdsg_ (3zds G:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1807020Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1807021Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1807602Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 1807603Protein automated matches [190388] (20 species)
    not a true protein
  7. 1807665Species Pseudomonas putida [TaxId:160488] [196877] (3 PDB entries)
  8. 1807672Domain d3zdsg_: 3zds G: [218265]
    automated match to d4aq6a_
    complexed with fe, hmq, hq9, m8o, omd, oxy, po4

Details for d3zdsg_

PDB Entry: 3zds (more details), 1.7 Å

PDB Description: structure of homogentisate 1,2-dioxygenase in complex with reaction intermediates of homogentisate with oxygen.
PDB Compounds: (G:) homogentisate 1,2-dioxygenase

SCOPe Domain Sequences for d3zdsg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zdsg_ b.82.1.0 (G:) automated matches {Pseudomonas putida [TaxId: 160488]}
dlhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselrrtwlyri
rpsalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaanagaekpa
gvsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiaviprgmkfrv
elldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvqlvqkflg
ehwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsptsvhgma
nmdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggaslhgvmsah
gpdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydscwatlpst
fnpnr

SCOPe Domain Coordinates for d3zdsg_:

Click to download the PDB-style file with coordinates for d3zdsg_.
(The format of our PDB-style files is described here.)

Timeline for d3zdsg_: