Lineage for d3zdhj_ (3zdh J:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073791Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2073792Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2073793Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 protein domains)
    automatically mapped to Pfam PF02931
  6. 2073794Protein Acetylcholine binding protein (ACHBP) [63714] (1 species)
  7. 2073795Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (8 PDB entries)
  8. 2073805Domain d3zdhj_: 3zdh J: [218255]
    automated match to d1uv6a_
    complexed with nag, so4, xrs

Details for d3zdhj_

PDB Entry: 3zdh (more details), 2.2 Å

PDB Description: Crystal structure of Ls-AChBP complexed with carbamoylcholine analogue N,N-dimethyl-4-(1-methyl-1H-imidazol-2-yloxy)butan-2-amine
PDB Compounds: (J:) acetylcholine binding protein

SCOPe Domain Sequences for d3zdhj_:

Sequence, based on SEQRES records: (download)

>d3zdhj_ b.96.1.1 (J:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkk

Sequence, based on observed residues (ATOM records): (download)

>d3zdhj_ b.96.1.1 (J:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdptddseyfsqysrfeildvtqkknsvt
ysccpeayedvevslnfrkk

SCOPe Domain Coordinates for d3zdhj_:

Click to download the PDB-style file with coordinates for d3zdhj_.
(The format of our PDB-style files is described here.)

Timeline for d3zdhj_: