SCOPe 2.06: Domain d3zdhf_: 3zdh F:

Lineage for d3zdhf_ (3zdh F:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
   automatically mapped to Pfam PF02931

6. Protein Acetylcholine binding protein (ACHBP) [63714] (1 species)

7. Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (8 PDB entries)

8. Domain d3zdhf_: 3zdh F: [218251]
   automated match to d1uv6a_
   complexed with nag, so4, xrs

Details for d3zdhf_

PDB Entry: 3zdh, 2.2 Å

PDB Description: crystal structure of ls-achbp complexed with carbamoylcholine analogue n,n-dimethyl-4-(1-methyl-1h-imidazol-2-yloxy)butan-2-amine

PDB Compounds: (F:) acetylcholine binding protein

SCOPe Domain Sequences for d3zdhf_:

Sequence, based on SEQRES records:

>d3zdhf_ b.96.1.1 (F:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkg

Sequence, based on observed residues (ATOM records):

>d3zdhf_ b.96.1.1 (F:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdptsddseyfsqysrfeildvtqkknsv
tysccpeayedvevslnfrkkg

Timeline for d3zdhf_:

• d3zdhf_ first appeared in SCOPe 2.03
  
• d3zdhf_ appears in SCOPe 2.05
  
• d3zdhf_ appears in SCOPe 2.07
  
• d3zdhf_ appears in the current release, SCOPe 2.08