Lineage for d5cgt_1 (5cgt 496-581)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.5: E set domains [49208] (27 proteins) 
Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species) 
Species Bacillus circulans, different strains [TaxId:1397] [49216] (29 PDB entries) 
Domain d5cgt_1: 5cgt 496-581 [21824]
Other proteins in same PDB: d5cgt_2, d5cgt_3, d5cgt_4
Details for d5cgt_1
PDB Entry: 5cgt (more details), 2.5 Å
PDB Description: maltotriose complex of preconditioned cyclodextrin glycosyltransferase mutant
SCOP Domain Sequences for d5cgt_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cgt_1 b.1.1.5 (496-581) Cyclodextrin glycosyltransferase, domain E {Bacillus circulans, different strains}
ttptighvgpvmgkpgnvvtidgrgfgstkgtvyfgttavtgaaitswedtqikvtipsv
aagnyavkvaasgvnsnaynnftilt
SCOP Domain Coordinates for d5cgt_1:
Click to download the PDB-style file with coordinates for d5cgt_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5cgt_1:
- d5cgt_1 first appeared (with stable ids) in SCOP 1.55
- d5cgt_1 appears in SCOP 1.59
- d5cgt_1 appears in SCOP 1.63
- d5cgt_1 appears in the current release, SCOPe 2.08, called d5cgta1
View in 3D
