SCOPe 2.05: Domain d3wg6a_: 3wg6 A:

Lineage for d3wg6a_ (3wg6 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.0: automated matches [191491] (1 protein)
   not a true family

6. Protein automated matches [190793] (24 species)
   not a true protein

7. Species Candida parapsilosis [TaxId:5480] [224874] (3 PDB entries)

8. Domain d3wg6a_: 3wg6 A: [218237]
   automated match to d1mzra_
   complexed with ndp

Details for d3wg6a_

PDB Entry: 3wg6, 2.2 Å

PDB Description: crystal structure of conjugated polyketone reductase c1 from candida parapsilosis complexed with nadph

PDB Compounds: (A:) Conjugated polyketone reductase C1

SCOPe Domain Sequences for d3wg6a_:

Sequence; same for both SEQRES and ATOM records:

>d3wg6a_ c.1.7.0 (A:) automated matches {Candida parapsilosis [TaxId: 5480]}
kefklsngnkipavafgtgtkyfkrghndldkqligtlelalrsgfrhidgaeiygtnke
igialknvglnrkdvfitdkynsgnhtydgkhskhqnpynalkadledlgleyvdlylih
fpyisekshgfdlveawrylerakneglarnigvsnftienlksildantdsipvvnqie
fsaylqdqtpgiveysqqqgilieaygplgpitqgrpgpldkvlsklsekykrnegqill
rwvlqrgilpitttskeerindvleifdfeldkededqitkvgkektlrqfskeyskyd

Timeline for d3wg6a_:

• d3wg6a_ first appeared in SCOPe 2.03
  
• d3wg6a_ appears in SCOPe 2.04
  
• d3wg6a_ appears in SCOPe 2.06
  
• d3wg6a_ appears in the current release, SCOPe 2.08