Lineage for d3wfga_ (3wfg A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729635Protein automated matches [190059] (14 species)
    not a true protein
  7. 2729657Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries)
  8. 2729668Domain d3wfga_: 3wfg A: [218236]
    automated match to d2aa6b_
    complexed with edo, wfg

Details for d3wfga_

PDB Entry: 3wfg (more details), 1.4 Å

PDB Description: mineralocorticoid receptor ligand-binding domain with compuond 2e
PDB Compounds: (A:) Mineralocorticoid receptor

SCOPe Domain Sequences for d3wfga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wfga_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpgfknlp
ledqitliqyswmsllsfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhq
islqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtkcpnns
gqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesg
nvkplyfhr

SCOPe Domain Coordinates for d3wfga_:

Click to download the PDB-style file with coordinates for d3wfga_.
(The format of our PDB-style files is described here.)

Timeline for d3wfga_: