Lineage for d3wcyi_ (3wcy I:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2318696Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2318697Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2319033Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
    contains an additional helix in one of the crossover connections
  6. 2319062Protein Interferon-beta [47309] (2 species)
  7. 2319066Species Mouse (Mus musculus) [TaxId:10090] [47311] (4 PDB entries)
    Uniprot P01575 22-182
    CA-atoms only
  8. 2319070Domain d3wcyi_: 3wcy I: [218234]
    automated match to d1wu3i_

Details for d3wcyi_

PDB Entry: 3wcy (more details), 2.9 Å

PDB Description: Murine Ifnar1 in complex with interferon-beta
PDB Compounds: (I:) Interferon beta

SCOPe Domain Sequences for d3wcyi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wcyi_ a.26.1.3 (I:) Interferon-beta {Mouse (Mus musculus) [TaxId: 10090]}
inykqlqlqertnirkcqelleqlngkinltyradfkipmemtekmqksytafaiqemlq
nvflvfrnnfsstgwnetivvrlldelhqqtvflktvleekqeerltwemsstalhlksy
ywrvqrylklmkynsyawmvvraeifrnfliirrltrnfq

SCOPe Domain Coordinates for d3wcyi_:

Click to download the PDB-style file with coordinates for d3wcyi_.
(The format of our PDB-style files is described here.)

Timeline for d3wcyi_: