![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins) contains an additional helix in one of the crossover connections |
![]() | Protein Interferon-beta [47309] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [47311] (4 PDB entries) Uniprot P01575 22-182 CA-atoms only |
![]() | Domain d3wcyi_: 3wcy I: [218234] automated match to d1wu3i_ |
PDB Entry: 3wcy (more details), 2.9 Å
SCOPe Domain Sequences for d3wcyi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wcyi_ a.26.1.3 (I:) Interferon-beta {Mouse (Mus musculus) [TaxId: 10090]} inykqlqlqertnirkcqelleqlngkinltyradfkipmemtekmqksytafaiqemlq nvflvfrnnfsstgwnetivvrlldelhqqtvflktvleekqeerltwemsstalhlksy ywrvqrylklmkynsyawmvvraeifrnfliirrltrnfq
Timeline for d3wcyi_: