SCOPe 2.07: Domain d1cgya1: 1cgy A:496-581

Lineage for d1cgya1 (1cgy A:496-581)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
   follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases

7. Species Bacillus circulans, different strains [TaxId:1397] [49216] (36 PDB entries)

8. Domain d1cgya1: 1cgy A:496-581 [21823]
   Other proteins in same PDB: d1cgya2, d1cgya3, d1cgya4
   complexed with ca, mal; mutant

Details for d1cgya1

PDB Entry: 1cgy, 2.5 Å

PDB Description: site directed mutations of the active site residue tyrosine 195 of cyclodextrin glyxosyltransferase from bacillus circulans strain 251 affecting activity and product specificity

PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d1cgya1:

Sequence; same for both SEQRES and ATOM records:

>d1cgya1 b.1.18.2 (A:496-581) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains [TaxId: 1397]}
tatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipa
vaggnynikvanaagtasnvydnfev

Timeline for d1cgya1:

• d1cgya1 first appeared (with stable ids) in SCOP 1.55, called d1cgy_1
  
• d1cgya1 appears in SCOPe 2.06
  
• d1cgya1 appears in the current release, SCOPe 2.08