SCOPe 2.04: Domain d3w9ya_: 3w9y A:

Lineage for d3w9ya_ (3w9y A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (79 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (95 PDB entries)

8. Domain d3w9ya_: 3w9y A: [218228]
   automated match to d2qora_

Details for d3w9ya_

PDB Entry: 3w9y, 2.2 Å

PDB Description: Crystal structure of the human DLG1 guanylate kinase domain

PDB Compounds: (A:) Disks large homolog 1

SCOPe Domain Sequences for d3w9ya_:

Sequence, based on SEQRES records:

>d3w9ya_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nytrpviilgpmkdrinddlisefpdkfgscvphttrpkrdyevdgrdyhfvtsreqmek
diqehkfieagqynnhlygtsvqsvrevaekgkhcildvsgnaikrlqiaqlypisifik
pksmenimemnkrlteeqarktferamkleqeftehftaivqgdtlediynqvkqiieeq
sgsyiwvpakekl

Sequence, based on observed residues (ATOM records):

>d3w9ya_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nytrpviilgpmkdrinddlisefpdkfgscvphttrpkrdyevdgrdyhfvtsreqmek
diqehkfieagqynnhlygtsvqsvrevaekgkhcildvsgnaikrlqiaqlypisifik
pksmferamkleqeftehftaivqgdtlediynqvkqiieeqsgsyiwvpakekl

Timeline for d3w9ya_:

• d3w9ya_ first appeared in SCOPe 2.03
  
• d3w9ya_ appears in SCOPe 2.05
  
• d3w9ya_ appears in the current release, SCOPe 2.08