SCOPe 2.03: Domain d3w8sa2: 3w8s A:78-206

Lineage for d3w8sa2 (3w8s A:78-206)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (36 species)
   not a true protein

7. Species Necator americanus [TaxId:51031] [224849] (3 PDB entries)

8. Domain d3w8sa2: 3w8s A:78-206 [218225]
   Other proteins in same PDB: d3w8sa1
   automated match to d1tw9a1
   complexed with gol, gsh, so4

Details for d3w8sa2

PDB Entry: 3w8s, 2.07 Å

PDB Description: Crystal structure of monomeric Na-GST-3, a glutathione s-transferase from the major human hookworm parasite Necator americanus

PDB Compounds: (A:) Glutathione S-transferase-3

SCOPe Domain Sequences for d3w8sa2:

Sequence; same for both SEQRES and ATOM records:

>d3w8sa2 a.45.1.0 (A:78-206) automated matches {Necator americanus [TaxId: 51031]}
agkcpfeealvdsitdqykdfineirpflrvamgfaegdleklsnevflparekffgfmt
nflkesksgylvgdsltfadlylaecasefakktptifdgfpeikahaekvrsnpalkkw
ietrpetkf

Timeline for d3w8sa2:

• d3w8sa2 is new in SCOPe 2.03-stable
  
• d3w8sa2 appears in SCOPe 2.04
  
• d3w8sa2 appears in the current release, SCOPe 2.08