SCOPe 2.03: Domain d3w8sa1: 3w8s A:2-77

Lineage for d3w8sa1 (3w8s A:2-77)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (107 species)
   not a true protein

7. Species Necator americanus [TaxId:51031] [224893] (3 PDB entries)

8. Domain d3w8sa1: 3w8s A:2-77 [218224]
   Other proteins in same PDB: d3w8sa2
   automated match to d1tw9a2
   complexed with gol, gsh, so4

Details for d3w8sa1

PDB Entry: 3w8s, 2.07 Å

PDB Description: Crystal structure of monomeric Na-GST-3, a glutathione s-transferase from the major human hookworm parasite Necator americanus

PDB Compounds: (A:) Glutathione S-transferase-3

SCOPe Domain Sequences for d3w8sa1:

Sequence; same for both SEQRES and ATOM records:

>d3w8sa1 c.47.1.0 (A:2-77) automated matches {Necator americanus [TaxId: 51031]}
vhykltyfdgrgaaeiirqifvlagqeyedirlshdewpkyknempfgqlpvlevdgkkl
aqsfaiarfvakkfgf

Timeline for d3w8sa1:

• d3w8sa1 is new in SCOPe 2.03-stable
  
• d3w8sa1 appears in SCOPe 2.04
  
• d3w8sa1 appears in the current release, SCOPe 2.08