SCOPe 2.07: Domain d3w6ha_: 3w6h A:

Lineage for d3w6ha_ (3w6h A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (18 PDB entries)

8. Domain d3w6ha_: 3w6h A: [218220]
   automated match to d1hcba_
   complexed with azm, flb, zn

Details for d3w6ha_

PDB Entry: 3w6h, 2.96 Å

PDB Description: Crystal structure of 19F probe-labeled hCAI in complex with acetazolamide

PDB Compounds: (A:) Carbonic anhydrase 1

SCOPe Domain Sequences for d3w6ha_:

Sequence; same for both SEQRES and ATOM records:

>d3w6ha_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]}
wgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvgh
sfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwn
sakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstl
lpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhn
nrptqplkgrtvrasf

Timeline for d3w6ha_:

• d3w6ha_ first appeared in SCOPe 2.03
  
• d3w6ha_ appears in SCOPe 2.06
  
• d3w6ha_ appears in the current release, SCOPe 2.08