SCOPe 2.08: Domain d3w5ib1: 3w5i B:2-200

Lineage for d3w5ib1 (3w5i B:2-200)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Gallionella capsiferriformans [TaxId:395494] [226649] (2 PDB entries)

8. Domain d3w5ib1: 3w5i B:2-200 [218217]
   Other proteins in same PDB: d3w5ia2, d3w5ib2
   automated match to d2cxxa1
   complexed with so4

Details for d3w5ib1

PDB Entry: 3w5i, 2.15 Å

PDB Description: Crystal structure of NfeoB from Gallionella capsiferriformans

PDB Compounds: (B:) Ferrous iron transport protein B

SCOPe Domain Sequences for d3w5ib1:

Sequence, based on SEQRES records:

>d3w5ib1 c.37.1.0 (B:2-200) automated matches {Gallionella capsiferriformans [TaxId: 395494]}
kriallgmpntgkstlfnrmtggaarvgnwpgitvellsgkillgadmveiidlpgiydl
hgfsddeqvvrhflhdnvpdlalvilnatqierqmslllqlkqlnmnivvllnmsdeakq
ygitidsrkmsellqipvfqlsgkygtgyqealqavtralryptpgmaenvrtqleqdeh
ieaemvrilksavqiparl

Sequence, based on observed residues (ATOM records):

>d3w5ib1 c.37.1.0 (B:2-200) automated matches {Gallionella capsiferriformans [TaxId: 395494]}
kriallgmpntgkstlfnrmtggaarvgnwpgitvellsgkillgadmveiidlpgiydl
hgfsddeqvvrhflhdnvpdlalvilnatqierqmslllqlkqlnmnivvllnmsdeakq
ygitidsrkmsellqipvfqlsgtgyqealqavtralryptpgmaenvrtqleqdehiea
emvrilksavqiparl

Timeline for d3w5ib1:

• d3w5ib1 first appeared in SCOPe 2.03, called d3w5ib_
  
• d3w5ib1 appears in SCOPe 2.07