Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Gallionella capsiferriformans [TaxId:395494] [226649] (2 PDB entries) |
Domain d3w5ia1: 3w5i A:2-197 [218216] Other proteins in same PDB: d3w5ia2, d3w5ib2 automated match to d2cxxa1 complexed with so4 |
PDB Entry: 3w5i (more details), 2.15 Å
SCOPe Domain Sequences for d3w5ia1:
Sequence, based on SEQRES records: (download)
>d3w5ia1 c.37.1.0 (A:2-197) automated matches {Gallionella capsiferriformans [TaxId: 395494]} kriallgmpntgkstlfnrmtggaarvgnwpgitvellsgkillgadmveiidlpgiydl hgfsddeqvvrhflhdnvpdlalvilnatqierqmslllqlkqlnmnivvllnmsdeakq ygitidsrkmsellqipvfqlsgkygtgyqealqavtralryptpgmaenvrtqleqdeh ieaemvrilksavqip
>d3w5ia1 c.37.1.0 (A:2-197) automated matches {Gallionella capsiferriformans [TaxId: 395494]} kriallgmpntgkstlfnrmtggaarvgnwpgitvellsgkillgadmveiidlpgiydl hgfsddeqvvrhflhdnvpdlalvilnatqierqmslllqlkqlnmnivvllnmsdeakq ygitidsrkmsellqipvfqltgyqealqavtralryptpgmaenvrtqleqdehieaem vrilksavqip
Timeline for d3w5ia1: