Lineage for d3w5eb_ (3w5e B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2014926Family a.211.1.2: PDEase [48548] (7 protein domains)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2014930Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species)
  7. 2014931Species Human (Homo sapiens) [TaxId:9606] [48550] (29 PDB entries)
    Uniprot Q07343 324-667
  8. 2014955Domain d3w5eb_: 3w5e B: [218213]
    automated match to d1f0ja_
    complexed with ca, nvw, zn

Details for d3w5eb_

PDB Entry: 3w5e (more details), 2.3 Å

PDB Description: crystal structure of phosphodiesterase 4b in complex with compound 31e
PDB Compounds: (B:) cAMP-specific 3',5'-cyclic phosphodiesterase 4B

SCOPe Domain Sequences for d3w5eb_:

Sequence, based on SEQRES records: (download)

>d3w5eb_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens) [TaxId: 9606]}
srfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfriss
dtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaai
hdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqt
lrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadl
snptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhp
lwetwadlvqpdaqdildtlednrnwyqsmipqspsppldeqnrdcqglmekfqfelt

Sequence, based on observed residues (ATOM records): (download)

>d3w5eb_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens) [TaxId: 9606]}
srfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfriss
dtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaai
hdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqt
lrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadl
snptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhp
lwetwadlvqpdaqdildtlednrnwyqsmipcqglmekfqfelt

SCOPe Domain Coordinates for d3w5eb_:

Click to download the PDB-style file with coordinates for d3w5eb_.
(The format of our PDB-style files is described here.)

Timeline for d3w5eb_: