Lineage for d3w5da3 (3w5d A:344-360,A:600-750)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2919808Family c.108.1.7: Meta-cation ATPase, catalytic domain P [81656] (3 proteins)
    interrupted by a large insertion, domain N
  6. 2919809Protein Calcium ATPase, catalytic domain P [81655] (1 species)
  7. 2919810Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81654] (42 PDB entries)
    Uniprot P04191
  8. 2919829Domain d3w5da3: 3w5d A:344-360,A:600-750 [218210]
    Other proteins in same PDB: d3w5da1, d3w5da2, d3w5da4
    automated match to d1wpga2
    complexed with na, pty, so4

Details for d3w5da3

PDB Entry: 3w5d (more details), 2.45 Å

PDB Description: Crystal structure of the calcium pump in the E2+Pi state
PDB Compounds: (A:) SERCA1a

SCOPe Domain Sequences for d3w5da3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w5da3 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ctsvicsdktgtlttnqXldpprkevmgsiqlcrdagirvimitgdnkgtaiaicrrigi
fgeneevadraytgrefddlplaeqreacrraccfarvepshkskiveylqsydeitamt
gdgvndapalkkaeigiamgsgtavaktasemvladdnfstivaaveeg

SCOPe Domain Coordinates for d3w5da3:

Click to download the PDB-style file with coordinates for d3w5da3.
(The format of our PDB-style files is described here.)

Timeline for d3w5da3: