SCOP 1.67: Domain d1cxh_1: 1cxh 496-581

Lineage for d1cxh_1 (1cxh 496-581)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (16 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
   follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases

7. Species Bacillus circulans, different strains [TaxId:1397] [49216] (36 PDB entries)

8. Domain d1cxh_1: 1cxh 496-581 [21821]
   Other proteins in same PDB: d1cxh_2, d1cxh_3, d1cxh_4
   complexed with ca, glc, mal

Details for d1cxh_1

PDB Entry: 1cxh, 2.4 Å

PDB Description: complex of cgtase with maltotetraose at room temperature and ph 9.6 based on diffraction data of a crystal soaked with maltoheptaose

SCOP Domain Sequences for d1cxh_1:

Sequence; same for both SEQRES and ATOM records:

>d1cxh_1 b.1.18.2 (496-581) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains}
tatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipa
vaggnynikvanaagtasnvydnfev

Timeline for d1cxh_1:

• d1cxh_1 first appeared (with stable ids) in SCOP 1.55
  
• d1cxh_1 appears in SCOP 1.65
  
• d1cxh_1 appears in SCOP 1.69
  
• d1cxh_1 appears in the current release, SCOPe 2.08, called d1cxha1