Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (18 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (16 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species) follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases |
Species Bacillus circulans, different strains [TaxId:1397] [49216] (36 PDB entries) |
Domain d1cxh_1: 1cxh 496-581 [21821] Other proteins in same PDB: d1cxh_2, d1cxh_3, d1cxh_4 complexed with ca, glc, mal |
PDB Entry: 1cxh (more details), 2.4 Å
SCOP Domain Sequences for d1cxh_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cxh_1 b.1.18.2 (496-581) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains} tatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipa vaggnynikvanaagtasnvydnfev
Timeline for d1cxh_1: