Lineage for d3w3ba_ (3w3b A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768957Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2768958Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. 2768959Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 2768980Species Human (Homo sapiens) [TaxId:9606] [49475] (322 PDB entries)
    Uniprot P02766 31-143
  8. 2769367Domain d3w3ba_: 3w3b A: [218201]
    automated match to d1f41a_

Details for d3w3ba_

PDB Entry: 3w3b (more details), 1.9 Å

PDB Description: Crystal structure of wild-type human transthyretin
PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d3w3ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w3ba_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

SCOPe Domain Coordinates for d3w3ba_:

Click to download the PDB-style file with coordinates for d3w3ba_.
(The format of our PDB-style files is described here.)

Timeline for d3w3ba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3w3bb_