SCOPe 2.03: Domain d3w2tb1: 3w2t B:38-508

Lineage for d3w2tb1 (3w2t B:38-508)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family)
   automatically mapped to Pfam PF00930

5. Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
   Pfam PF00930

6. Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82174] (68 PDB entries)
   Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487

8. Domain d3w2tb1: 3w2t B:38-508 [218199]
   Other proteins in same PDB: d3w2ta2, d3w2tb2
   automated match to d1j2ea1
   complexed with gol, lf7, nag

Details for d3w2tb1

PDB Entry: 3w2t, 2.36 Å

PDB Description: crystal structure of human depiptidyl peptidase iv (dpp-4) in complex with vildagliptin

PDB Compounds: (B:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d3w2tb1:

Sequence; same for both SEQRES and ATOM records:

>d3w2tb1 b.70.3.1 (B:38-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfde
fghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtw
spvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwws
pngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdsls
svtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrw
nclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfi
tkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyy
svsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

Timeline for d3w2tb1:

• d3w2tb1 is new in SCOPe 2.03-stable
  
• d3w2tb1 appears in SCOPe 2.04
  
• d3w2tb1 appears in the current release, SCOPe 2.08