SCOPe 2.03: Domain d3w2ga2: 3w2g A:126-272

Lineage for d3w2ga2 (3w2g A:126-272)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.1: Reductases [52344] (5 proteins)

6. Protein cytochrome b5 reductase [52357] (3 species)

7. Species Pig (Sus scrofa), liver [TaxId:9823] [52358] (7 PDB entries)

8. Domain d3w2ga2: 3w2g A:126-272 [218191]
   Other proteins in same PDB: d3w2ga1
   automated match to d1umka2
   complexed with fad, nad

Details for d3w2ga2

PDB Entry: 3w2g, 1.68 Å

PDB Description: Crystal structure of fully reduced form of NADH-cytochrome b5 reductase from pig liver

PDB Compounds: (A:) NADH-cytochrome b5 reductase 3

SCOPe Domain Sequences for d3w2ga2:

Sequence; same for both SEQRES and ATOM records:

>d3w2ga2 c.25.1.1 (A:126-272) cytochrome b5 reductase {Pig (Sus scrofa), liver [TaxId: 9823]}
gkfairpdkksspviktvksvgmiaggtgitpmlqviraimkdpddhtvchllfanqtek
dillrpeleelrnehsarfklwytvdrapeawdysqgfvneemirdhlpppeeeplvlmc
gpppmiqyaclpnlervghpkercfaf

Timeline for d3w2ga2:

• d3w2ga2 is new in SCOPe 2.03-stable
  
• d3w2ga2 appears in SCOPe 2.04
  
• d3w2ga2 appears in the current release, SCOPe 2.08