Lineage for d3w2fa1 (3w2f A:2-125)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2403031Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2403099Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 2403104Protein cytochrome b5 reductase [50427] (3 species)
  7. 2403112Species Pig (Sus scrofa), liver [TaxId:9823] [50428] (9 PDB entries)
  8. 2403118Domain d3w2fa1: 3w2f A:2-125 [218188]
    Other proteins in same PDB: d3w2fa2
    automated match to d1umka1
    complexed with fad, nad

Details for d3w2fa1

PDB Entry: 3w2f (more details), 1.76 Å

PDB Description: Crystal structure of oxidation intermediate (10 min) of NADH-cytochrome b5 reductase from pig liver
PDB Compounds: (A:) NADH-cytochrome b5 reductase 3

SCOPe Domain Sequences for d3w2fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w2fa1 b.43.4.2 (A:2-125) cytochrome b5 reductase {Pig (Sus scrofa), liver [TaxId: 9823]}
tpaitlenpdikyplrlidkevvnhdtrrfrfalpspehilglpvgqhiylsaridgnlv
irpytpvssdddkgfvdlvikvyfkdthpkfpaggkmsqylesmkigdtiefrgpngllv
yqgk

SCOPe Domain Coordinates for d3w2fa1:

Click to download the PDB-style file with coordinates for d3w2fa1.
(The format of our PDB-style files is described here.)

Timeline for d3w2fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3w2fa2