| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) ![]() binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
| Family c.25.1.1: Reductases [52344] (5 proteins) |
| Protein cytochrome b5 reductase [52357] (3 species) |
| Species Pig (Sus scrofa), liver [TaxId:9823] [52358] (9 PDB entries) |
| Domain d3w2ea2: 3w2e A:126-272 [218187] Other proteins in same PDB: d3w2ea1 automated match to d1umka2 complexed with fad, nad |
PDB Entry: 3w2e (more details), 2.1 Å
SCOPe Domain Sequences for d3w2ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w2ea2 c.25.1.1 (A:126-272) cytochrome b5 reductase {Pig (Sus scrofa), liver [TaxId: 9823]}
gkfairpdkksspviktvksvgmiaggtgitpmlqviraimkdpddhtvchllfanqtek
dillrpeleelrnehsarfklwytvdrapeawdysqgfvneemirdhlpppeeeplvlmc
gpppmiqyaclpnlervghpkercfaf
Timeline for d3w2ea2: