SCOPe 2.03: Domain d3w0lc1: 3w0l C:6-211

Lineage for d3w0lc1 (3w0l C:6-211)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (35 species)
   not a true protein

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [226729] (1 PDB entry)

8. Domain d3w0lc1: 3w0l C:6-211 [218181]
   automated match to d1bdga1
   complexed with f6r, na, so4

Details for d3w0lc1

PDB Entry: 3w0l, 2.92 Å

PDB Description: The crystal structure of Xenopus Glucokinase and Glucokinase Regulatory Protein complex

PDB Compounds: (C:) Glucokinase

SCOPe Domain Sequences for d3w0lc1:

Sequence, based on SEQRES records:

>d3w0lc1 c.55.1.0 (C:6-211) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
qnevdqilsefhlqeedlhvlmcrmqaemerglhletneeasvkmlptyvrstpdgsevg
dflaldlggtnfrvmlvkvgedlegqwkvetkhkmysipvdamtgtaemlfdyiaecisd
yldqqnmkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgllrdaikrr
gdfemdvvamvndtvatmiscyyedh

Sequence, based on observed residues (ATOM records):

>d3w0lc1 c.55.1.0 (C:6-211) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
qnevdqilsefhlqeedlhvlmcrmqaemerglhletneeasvkmlptyvrstpdgsevg
dflaldlggtnfrvmlvkvgedlegqwkvetkhkmysipfdyiaecisdyldqqnmkhkk
lplgftfvvgllrdaikrrgdfemdvvamvndtvatmiscyyedh

Timeline for d3w0lc1:

• d3w0lc1 is new in SCOPe 2.03-stable
  
• d3w0lc1 appears in SCOPe 2.04
  
• d3w0lc1 appears in the current release, SCOPe 2.08