Lineage for d3w00b_ (3w00 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1338072Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 1338073Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 1338296Protein PcrB protein homolog YerE [102046] (2 species)
    provisional classification; it is not known whether this protein binds FMN or not
  7. 1338297Species Bacillus subtilis [TaxId:1423] [102047] (5 PDB entries)
  8. 1338307Domain d3w00b_: 3w00 B: [218177]
    automated match to d3vzza_
    complexed with 1gp, fps, po4

Details for d3w00b_

PDB Entry: 3w00 (more details), 2.5 Å

PDB Description: Crystal structure of PcrB complexed with G1P and FsPP from bacillus subtilis subap. subtilis str. 168
PDB Compounds: (B:) Heptaprenylglyceryl phosphate synthase

SCOPe Domain Sequences for d3w00b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w00b_ c.1.4.1 (B:) PcrB protein homolog YerE {Bacillus subtilis [TaxId: 1423]}
ydvtewkhvfkldpnkdlpdeqleilcesgtdaviiggsdgvtednvlrmmskvrrflvp
cvlevsaieaivpgfdlyfipsvlnsknadwivgmhqkamkeygelmsmeeivaegycia
npdckaaalteadadlnmddivayarvsellqlpifyleysgvlgdieavkktkavlets
tlfygggikdaetakqyaehadvivvgnavyedfdralktvaavkg

SCOPe Domain Coordinates for d3w00b_:

Click to download the PDB-style file with coordinates for d3w00b_.
(The format of our PDB-style files is described here.)

Timeline for d3w00b_: