Lineage for d3vzrb_ (3vzr B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846723Species Cupriavidus necator [TaxId:381666] [224880] (4 PDB entries)
  8. 2846735Domain d3vzrb_: 3vzr B: [218167]
    automated match to d3ennd_
    mutant

Details for d3vzrb_

PDB Entry: 3vzr (more details), 2.9 Å

PDB Description: Crystal structure of T173S mutant of PhaB from Ralstonia eutropha
PDB Compounds: (B:) Acetoacetyl-CoA reductase

SCOPe Domain Sequences for d3vzrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vzrb_ c.2.1.0 (B:) automated matches {Cupriavidus necator [TaxId: 381666]}
qriayvtggmggigtaicqrlakdgfrvvagcgpnsprrekwleqqkalgfdfiasegnv
adwdstktafdkvksevgevdvlinnagitrdvvfrkmtradwdavidtnltslfnvtkq
vidgmadrgwgrivnissvngqkgqfgqtnystakaglhgftmalaqevaskgvtvntvs
pgyiatdmvkairqdvldkivatipvkrlglpeeiasicawlsseesgfstgadfslngg
lhmg

SCOPe Domain Coordinates for d3vzrb_:

Click to download the PDB-style file with coordinates for d3vzrb_.
(The format of our PDB-style files is described here.)

Timeline for d3vzrb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3vzra_