SCOP 1.61: Domain d1cdg_1: 1cdg 496-581

Lineage for d1cdg_1 (1cdg 496-581)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.5: E set domains [49208] (27 proteins)

6. Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species)

7. Species Bacillus circulans, different strains [TaxId:1397] [49216] (29 PDB entries)

8. Domain d1cdg_1: 1cdg 496-581 [21816]
   Other proteins in same PDB: d1cdg_2, d1cdg_3, d1cdg_4

Details for d1cdg_1

PDB Entry: 1cdg, 2 Å

PDB Description: nucleotide sequence and x-ray structure of cyclodextrin glycosyltransferase from bacillus circulans strain 251 in a maltose- dependent crystal form

SCOP Domain Sequences for d1cdg_1:

Sequence; same for both SEQRES and ATOM records:

>d1cdg_1 b.1.1.5 (496-581) Cyclodextrin glycosyltransferase, domain E {Bacillus circulans, different strains}
tatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipa
vaggnynikvanaagtasnvydnfev

Timeline for d1cdg_1:

• d1cdg_1 first appeared (with stable ids) in SCOP 1.55
  
• d1cdg_1 appears in SCOP 1.59
  
• d1cdg_1 appears in SCOP 1.63
  
• d1cdg_1 appears in the current release, SCOPe 2.08, called d1cdga1