Lineage for d1cdg_1 (1cdg 496-581)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104969Family b.1.1.5: E set domains [49208] (25 proteins)
  6. 105015Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species)
  7. 105016Species Bacillus circulans, different strains [TaxId:1397] [49216] (29 PDB entries)
  8. 105019Domain d1cdg_1: 1cdg 496-581 [21816]
    Other proteins in same PDB: d1cdg_2, d1cdg_3, d1cdg_4

Details for d1cdg_1

PDB Entry: 1cdg (more details), 2 Å

PDB Description: nucleotide sequence and x-ray structure of cyclodextrin glycosyltransferase from bacillus circulans strain 251 in a maltose- dependent crystal form

SCOP Domain Sequences for d1cdg_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cdg_1 b.1.1.5 (496-581) Cyclodextrin glycosyltransferase, domain E {Bacillus circulans, different strains}
tatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipa
vaggnynikvanaagtasnvydnfev

SCOP Domain Coordinates for d1cdg_1:

Click to download the PDB-style file with coordinates for d1cdg_1.
(The format of our PDB-style files is described here.)

Timeline for d1cdg_1: