SCOPe 2.08: Domain d3vznb_: 3vzn B:

Lineage for d3vznb_ (3vzn B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (21 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Bacillus circulans [TaxId:1397] [49980] (21 PDB entries)

8. Domain d3vznb_: 3vzn B: [218158]
   automated match to d3vzka_
   complexed with so4; mutant

Details for d3vznb_

PDB Entry: 3vzn, 1.67 Å

PDB Description: crystal structure of the bacillus circulans endo-beta-(1,4)-xylanase (bcx) n35e mutant with glu78 covalently bonded to 2-deoxy-2-fluoro- xylobiose

PDB Compounds: (B:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d3vznb_:

Sequence; same for both SEQRES and ATOM records:

>d3vznb_ b.29.1.11 (B:) Xylanase II {Bacillus circulans [TaxId: 1397]}
astdywqnwtdgggivnavngsggnysvnwsntgefvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

Timeline for d3vznb_:

• d3vznb_ first appeared in SCOPe 2.03
  
• d3vznb_ appears in SCOPe 2.07