SCOPe 2.04: Domain d3vzma_: 3vzm A:

Lineage for d3vzma_ (3vzm A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (18 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Bacillus circulans [TaxId:1397] [49980] (21 PDB entries)

8. Domain d3vzma_: 3vzm A: [218156]
   automated match to d3vzja_
   mutant

Details for d3vzma_

PDB Entry: 3vzm, 1.86 Å

PDB Description: crystal structure of the bacillus circulans endo-beta-(1,4)-xylanase (bcx) e172h mutant with glu78 covalently bonded to 2-deoxy-2-fluoro- xylobiose

PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d3vzma_:

Sequence; same for both SEQRES and ATOM records:

>d3vzma_ b.29.1.11 (A:) Xylanase II {Bacillus circulans [TaxId: 1397]}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmathgyqssgss
nvtvw

Timeline for d3vzma_:

• d3vzma_ first appeared in SCOPe 2.03
  
• d3vzma_ appears in SCOPe 2.05
  
• d3vzma_ appears in the current release, SCOPe 2.08