SCOPe 2.03: Domain d3vyuc2: 3vyu C:156-336

Lineage for d3vyuc2 (3vyu C:156-336)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families)

5. Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins)

6. Protein Hydrogenase expression/formation protein HypE [160783] (1 species)

7. Species Thermococcus kodakaraensis [TaxId:311400] [160784] (3 PDB entries)
   Uniprot Q5JII7 156-334

8. Domain d3vyuc2: 3vyu C:156-336 [218155]
   Other proteins in same PDB: d3vyua_, d3vyuc1
   automated match to d2z1ea2
   complexed with sf4

Details for d3vyuc2

PDB Entry: 3vyu, 2.75 Å

PDB Description: Crystal structure of the HypC-HypD-HypE complex (form II)

PDB Compounds: (C:) Hydrogenase expression/formation protein HypE

SCOPe Domain Sequences for d3vyuc2:

Sequence; same for both SEQRES and ATOM records:

>d3vyuc2 d.139.1.1 (C:156-336) Hydrogenase expression/formation protein HypE {Thermococcus kodakaraensis [TaxId: 311400]}
vsdagakvgdavlvsgtigdhgialmshregiafetelksdvapiwdvvkavaetigwen
ihamkdptraglsnalneiarksnvgilvreadipirpevraasemlgispydvanegkv
vmvvareyaeealeamrktekgrnaaiigeviadyrgkvlletgiggkrfmeppegdpvp
r

Timeline for d3vyuc2:

• d3vyuc2 is new in SCOPe 2.03-stable
  
• d3vyuc2 appears in SCOPe 2.04
  
• d3vyuc2 appears in the current release, SCOPe 2.08