Lineage for d3vyuc2 (3vyu C:156-336)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978140Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 2978141Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 2978142Family d.139.1.1: PurM C-terminal domain-like [56043] (9 proteins)
  6. 2978168Protein Hydrogenase expression/formation protein HypE [160783] (1 species)
  7. 2978169Species Thermococcus kodakaraensis [TaxId:311400] [160784] (3 PDB entries)
    Uniprot Q5JII7 156-334
  8. 2978172Domain d3vyuc2: 3vyu C:156-336 [218155]
    Other proteins in same PDB: d3vyua_, d3vyuc1
    automated match to d2z1ea2
    complexed with sf4

Details for d3vyuc2

PDB Entry: 3vyu (more details), 2.75 Å

PDB Description: Crystal structure of the HypC-HypD-HypE complex (form II)
PDB Compounds: (C:) Hydrogenase expression/formation protein HypE

SCOPe Domain Sequences for d3vyuc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vyuc2 d.139.1.1 (C:156-336) Hydrogenase expression/formation protein HypE {Thermococcus kodakaraensis [TaxId: 311400]}
vsdagakvgdavlvsgtigdhgialmshregiafetelksdvapiwdvvkavaetigwen
ihamkdptraglsnalneiarksnvgilvreadipirpevraasemlgispydvanegkv
vmvvareyaeealeamrktekgrnaaiigeviadyrgkvlletgiggkrfmeppegdpvp
r

SCOPe Domain Coordinates for d3vyuc2:

Click to download the PDB-style file with coordinates for d3vyuc2.
(The format of our PDB-style files is described here.)

Timeline for d3vyuc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vyuc1
View in 3D
Domains from other chains:
(mouse over for more information)
d3vyua_