Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.14: HupF/HypC-like [159127] (1 family) contains extra C-terminal helix packed against the beta-barrel side automatically mapped to Pfam PF01455 |
Family b.40.14.1: HupF/HypC-like [159128] (1 protein) Pfam PF01455 |
Protein Hydrogenase expression/formation protein HypC [159129] (3 species) |
Species Thermococcus kodakaraensis [TaxId:311400] [159132] (5 PDB entries) Uniprot Q5JII0 2-72 |
Domain d3vyta_: 3vyt A: [218152] automated match to d3vysa_ complexed with cl, mg, sf4 |
PDB Entry: 3vyt (more details), 2.25 Å
SCOPe Domain Sequences for d3vyta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vyta_ b.40.14.1 (A:) Hydrogenase expression/formation protein HypC {Thermococcus kodakaraensis [TaxId: 311400]} lavpgkvievngpvavvdfggvkrevrldlmpdtkpgdwvivhtgfaiekld
Timeline for d3vyta_: