SCOP 1.73: Domain d1cgta1: 1cgt A:495-579

Lineage for d1cgta1 (1cgt A:495-579)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (20 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (19 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
   follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases

7. Species Bacillus circulans, different strains [TaxId:1397] [49216] (36 PDB entries)

8. Domain d1cgta1: 1cgt A:495-579 [21815]
   Other proteins in same PDB: d1cgta2, d1cgta3, d1cgta4
   complexed with ca

Details for d1cgta1

PDB Entry: 1cgt, 2 Å

PDB Description: structure of cyclodextrin glycosyltransferase refined at 2.0 angstroms resolution

PDB Compounds: (A:) cyclodextrin glycosyl-transferase

SCOP Domain Sequences for d1cgta1:

Sequence; same for both SEQRES and ATOM records:

>d1cgta1 b.1.18.2 (A:495-579) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains [TaxId: 1397]}
ettptighvgpvmgkpgnvvtidgrgfgstkgtvyfgttavtgaaitswedtqikvtips
vaagnyavkvaasgvnsnaynnfti

Timeline for d1cgta1:

• d1cgta1 first appeared (with stable ids) in SCOP 1.55, called d1cgt_1
  
• d1cgta1 was called d1cgt_1 in SCOP 1.71
  
• d1cgta1 appears in SCOP 1.75
  
• d1cgta1 appears in the current release, SCOPe 2.08