Lineage for d3vxdc_ (3vxd C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004283Family a.102.1.0: automated matches [191318] (1 protein)
    not a true family
  6. 2004284Protein automated matches [190108] (16 species)
    not a true protein
  7. 2004313Species Streptococcus agalactiae [TaxId:211110] [226492] (2 PDB entries)
  8. 2004316Domain d3vxdc_: 3vxd C: [218142]
    automated match to d2fv1a_
    complexed with so4; mutant

Details for d3vxdc_

PDB Entry: 3vxd (more details), 2 Å

PDB Description: Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae
PDB Compounds: (C:) Putative uncharacterized protein gbs1889

SCOPe Domain Sequences for d3vxdc_:

Sequence, based on SEQRES records: (download)

>d3vxdc_ a.102.1.0 (C:) automated matches {Streptococcus agalactiae [TaxId: 211110]}
mmkikpvkvesienpkrflnsrlltkieveeaiekalkqlyinidyfgeeyptpatfnni
ykvmdntewtngfwtgclwlayeynqdkklkniahknvlsflnrinnrialdhhnlgfly
tpsctaeyringdvkaleatikaadklmeryqekggfiqawgelgykehyrliidcllni
qllffayeqtgdekyrqvavnhfyasannvvrddssafhtfyfdpetgeplkgvtrqgys
desswargqawgiygiplsyrkmkdyqqiilfkgmtnyflnrlpedkvsywdliftdgsg
qprdtsatatavcgihemlkylpevdpdketykyamhtmlrslieqysnneliagrplll
hgvyswhsgkgvdegniwgdyyylealirfykdwelyw

Sequence, based on observed residues (ATOM records): (download)

>d3vxdc_ a.102.1.0 (C:) automated matches {Streptococcus agalactiae [TaxId: 211110]}
mmkikpvkvesienpkrflnsrlltkieveeaiekalkqlyinidyfgeeyptpatfnni
ykvmdntewtngfwtgclwlayeynqdkklkniahknvlsflnrinnrialdhhnlgfly
tpsctaeyringdvkaleatikaadklmeryqliidcllniqllffayeqtgdekyrqva
vnhfyasannvvrddssafhtfysswargqawgiygiplsyrkmkdyqqiilfkgmtnyf
lnrlpedkvsywdliftdgsgqprdtsatatavcgihemlkylpevdpdketykyamhtm
lrslieqysnneliagrplllhgvyswhsgkgvdegniwgdyyylealirfykdwelyw

SCOPe Domain Coordinates for d3vxdc_:

Click to download the PDB-style file with coordinates for d3vxdc_.
(The format of our PDB-style files is described here.)

Timeline for d3vxdc_: