SCOP 1.75: Domain d1svba1: 1svb A:303-395

Lineage for d1svba1 (1svb A:303-395)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (23 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (2 proteins)

6. Protein Envelope glycoprotein [49213] (5 species)

7. Species Tick-borne encephalitis virus [TaxId:11084] [49214] (2 PDB entries)

8. Domain d1svba1: 1svb A:303-395 [21814]
   Other proteins in same PDB: d1svba2
   complexed with nag

Details for d1svba1

PDB Entry: 1svb, 1.9 Å

PDB Description: envelope glycoprotein from tick-borne encephalitis virus

PDB Compounds: (A:) tick-borne encephalitis virus glycoprotein

SCOP Domain Sequences for d1svba1:

Sequence; same for both SEQRES and ATOM records:

>d1svba1 b.1.18.4 (A:303-395) Envelope glycoprotein {Tick-borne encephalitis virus [TaxId: 11084]}
tytmcdktkftwkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitpnp
tienngggfiemqlppgdniiyvgelshqwfqk

Timeline for d1svba1:

• d1svba1 first appeared (with stable ids) in SCOP 1.55, called d1svb_1
  
• d1svba1 appears in SCOP 1.73
  
• d1svba1 appears in SCOPe 2.01
  
• d1svba1 appears in the current release, SCOPe 2.08