SCOP 1.61: Domain d1svb_1: 1svb 303-395

Lineage for d1svb_1 (1svb 303-395)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.5: E set domains [49208] (27 proteins)

6. Protein Envelope glycoprotein, domain III (C-terminal) [49213] (1 species)

7. Species Tick-borne encephalitis virus [TaxId:11084] [49214] (1 PDB entry)

8. Domain d1svb_1: 1svb 303-395 [21814]
   Other proteins in same PDB: d1svb_2

Details for d1svb_1

PDB Entry: 1svb, 1.9 Å

PDB Description: envelope glycoprotein from tick-borne encephalitis virus

SCOP Domain Sequences for d1svb_1:

Sequence; same for both SEQRES and ATOM records:

>d1svb_1 b.1.1.5 (303-395) Envelope glycoprotein, domain III (C-terminal) {Tick-borne encephalitis virus}
tytmcdktkftwkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitpnp
tienngggfiemqlppgdniiyvgelshqwfqk

Timeline for d1svb_1:

• d1svb_1 first appeared (with stable ids) in SCOP 1.55
  
• d1svb_1 appears in SCOP 1.59
  
• d1svb_1 appears in SCOP 1.63
  
• d1svb_1 appears in the current release, SCOPe 2.08, called d1svba1