Lineage for d1svba1 (1svb A:303-395)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765451Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 2765452Protein Envelope glycoprotein [49213] (5 species)
  7. 2765477Species Tick-borne encephalitis virus [TaxId:11084] [49214] (2 PDB entries)
  8. 2765478Domain d1svba1: 1svb A:303-395 [21814]
    Other proteins in same PDB: d1svba2
    complexed with nag

Details for d1svba1

PDB Entry: 1svb (more details), 1.9 Å

PDB Description: envelope glycoprotein from tick-borne encephalitis virus
PDB Compounds: (A:) tick-borne encephalitis virus glycoprotein

SCOPe Domain Sequences for d1svba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svba1 b.1.18.4 (A:303-395) Envelope glycoprotein {Tick-borne encephalitis virus [TaxId: 11084]}
tytmcdktkftwkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitpnp
tienngggfiemqlppgdniiyvgelshqwfqk

SCOPe Domain Coordinates for d1svba1:

Click to download the PDB-style file with coordinates for d1svba1.
(The format of our PDB-style files is described here.)

Timeline for d1svba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1svba2