SCOPe 2.08: Domain d3vwxd2: 3vwx D:88-222

Lineage for d3vwxd2 (3vwx D:88-222)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species House fly (Musca domestica) [TaxId:7370] [226606] (2 PDB entries)

8. Domain d3vwxd2: 3vwx D:88-222 [218139]
   Other proteins in same PDB: d3vwxa1, d3vwxb1, d3vwxc1, d3vwxd1
   automated match to d1r5aa1
   complexed with gsh

Details for d3vwxd2

PDB Entry: 3vwx, 1.8 Å

PDB Description: Structural analysis of an epsilon-class glutathione S-transferase from housefly, Musca domestica

PDB Compounds: (D:) Glutathione s-transferase 6B

SCOPe Domain Sequences for d3vwxd2:

Sequence; same for both SEQRES and ATOM records:

>d3vwxd2 a.45.1.0 (D:88-222) automated matches {House fly (Musca domestica) [TaxId: 7370]}
kdllkravvdqrmyfeagvlfqgglrnitaplffrnqtqipqhqidsivesygflesflk
nnkymagdhltiadfsivtsvtslvafaeidqskfpklsawlkslqslpfyeeangagak
qlvamvksknltivp

Timeline for d3vwxd2:

• d3vwxd2 first appeared in SCOPe 2.03
  
• d3vwxd2 appears in SCOPe 2.07